Protein Info for MMP_RS00985 in Methanococcus maripaludis S2

Annotation: CDC48 family AAA ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 TIGR01243: AAA family ATPase, CDC48 subfamily" amino acids 2 to 770 (769 residues), 1183.7 bits, see alignment E=0 PF02359: CDC48_N" amino acids 4 to 86 (83 residues), 101.2 bits, see alignment E=4e-32 PF02933: CDC48_2" amino acids 102 to 164 (63 residues), 59.6 bits, see alignment 2.6e-19 PF05496: RuvB_N" amino acids 212 to 288 (77 residues), 32.4 bits, see alignment E=1e-10 PF06068: TIP49" amino acids 212 to 257 (46 residues), 24.7 bits, see alignment 1.7e-08 amino acids 542 to 596 (55 residues), 25.3 bits, see alignment 1.2e-08 PF07728: AAA_5" amino acids 213 to 284 (72 residues), 22 bits, see alignment E=1.9e-07 PF00004: AAA" amino acids 214 to 343 (130 residues), 163.2 bits, see alignment E=5.7e-51 amino acids 544 to 675 (132 residues), 156.8 bits, see alignment E=5.7e-49 PF17862: AAA_lid_3" amino acids 427 to 463 (37 residues), 38.8 bits, see alignment 7.3e-13 amino acids 698 to 743 (46 residues), 65.1 bits, see alignment 4.2e-21

Best Hits

KEGG orthology group: K13525, transitional endoplasmic reticulum ATPase (inferred from 100% identity to mmp:MMP0176)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0U2 at UniProt or InterPro

Protein Sequence (788 amino acids)

>MMP_RS00985 CDC48 family AAA ATPase (Methanococcus maripaludis S2)
MVDLMVAEAYQGDVGKGIVRIDPLTMEKLSLKAGDAIEIAGKEKTYATVWRGYLEDQGKG
IIRMDGILRQNTKAGIGDKVKITVVEVKEAKKITLAPMQAVRFSTGFESYVGSRLVEQVV
DKGSKVVIGVLGTAFPFIVTGTTPKGPVKINEYTQIELKTEPVTELKETKVPNVTYEDIG
GLKEEVKKIREMVELPMRYPELFDKLGIEPPKGVLLAGPPGTGKTLLAKAVANEAGANFY
TINGPEIMSKYVGETEENLRKIFEEAEENSPSIIFIDEIDAVAPKRDEASGEVERRMVAQ
LLTLMDGLESRGQLVILAATNRPDSIDMALRRPGRLDREITIGIPDRHGRNEILQIHTRN
MPLQPDYEKSDVISILNELVGEYDRSKIESLVKLVEKASSEEEIEKILKDGEVEDKVKVK
LNQLMVKELADKTHGFAGADLAALSKEAAMKTLRRFLPDIDLEKEEIPREVLDKIKVTKE
DFVGGLKEVEPSALREVLVEVPNIKWSDVGGLEDIKQDLKEAVEWPIKNKEMFERMGIRP
PKGVLLFGPPGTGKTLLAKAVANESEANFISVKGPEIFSKWVGESEKAIREIFRKARQAA
PTVIFFDEIDSVAPKRGMDFGSSGVTEKVVNQLLTELDGLEEPKDVVIIAATNRPDILDQ
ALLRPGRLDRIVLVPIPNETARLEIFKVHTKGMPIGKDVNLEKLAKETKGYTGADIEAVC
REAAMIALRENINSEHVESRHFDGAFKRIAPSVKDDDMDEYKDLAKEYGQNAGVSEIEKG
PENTGYHG