Protein Info for MMP_RS00960 in Methanococcus maripaludis S2

Annotation: iron export ABC transporter permease subunit FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 6 to 245 (240 residues), 238.1 bits, see alignment E=5e-75 PF03649: UPF0014" amino acids 7 to 242 (236 residues), 235.8 bits, see alignment E=2.4e-74

Best Hits

Swiss-Prot: 46% identical to Y938_METJA: UPF0014 membrane protein MJ0938 (MJ0938) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 100% identity to mmp:MMP0171)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0U7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>MMP_RS00960 iron export ABC transporter permease subunit FetB (Methanococcus maripaludis S2)
MIKVFESLLISFSFVLLSLILIFKEKLGIGKEIFIAEIMALIQLVVLGYVIGIVFNLGIY
YASIMILFMVSVSAFMVKRNVTKEKNRKIVCAAFLSTITITIISLIILTVSKTVLFEVRY
LIPLMGMVIGNSTNAMSIGLERFLSDLKSEKDVLWGYLALGATEKQAVNTFVKKAVRAAL
TPHLNSTKAVGLIFIPGAMVGMLLAGVDPLEAAKVQITIMWMIMASNIFSVTIACYLLYK
EFIHQISS