Protein Info for MMP_RS00950 in Methanococcus maripaludis S2

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 92 (27 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details PF02163: Peptidase_M50" amino acids 118 to 349 (232 residues), 96.5 bits, see alignment E=1.5e-31 PF13180: PDZ_2" amino acids 201 to 267 (67 residues), 32.9 bits, see alignment E=6.3e-12

Best Hits

Swiss-Prot: 49% identical to Y971_METJA: Uncharacterized protein MJ0971 (MJ0971) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0169)

Predicted SEED Role

"Uncharacterized protein MJ0971"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0U9 at UniProt or InterPro

Protein Sequence (375 amino acids)

>MMP_RS00950 site-2 protease family protein (Methanococcus maripaludis S2)
MELTSTAVLLFFLIFWTVLYLINHNKDKLGINLDLKTYMGIFGILRTQVGMNIIKKLGKY
KLWQKLAYLSIPVCVVISIYTFYAFILSTVGLFDGTVEKEAAKPIIFLFGSTIPWIPGIL
AIIIGVTIHELSHGIVAASFGQKIKSSGLLLALGIPMGAFVELGDEFKDSKPKIRGAIAA
AGPISNVLVFFLVLFAMPYFTGMDSKLTITDVLEDTPAYGIIFEGDVIYSINGKLVNSLN
DFYDAVGDIQPEQSVELVVLRNNEVNSYYITTSEEGKMGIVSEPSKTVMYILQTLYWTSL
LNMLLGFFNLLPAAPLDGYHIWMALPDAIRDFRKNNWFVSKIANLVGWVISERNLNSISI
FVWLAILASMIYSFI