Protein Info for MMP_RS00900 in Methanococcus maripaludis S2
Annotation: 50S ribosomal protein L39e
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL39_METM6: 50S ribosomal protein L39e (rpl39e) from Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
KEGG orthology group: K02924, large subunit ribosomal protein L39e (inferred from 100% identity to mmq:MmarC5_1516)Predicted SEED Role
"LSU ribosomal protein L39e" in subsystem Ribosome LSU eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6M0V9 at UniProt or InterPro
Protein Sequence (51 amino acids)
>MMP_RS00900 50S ribosomal protein L39e (Methanococcus maripaludis S2) MAGNKPLGKKIRLAKALKQNRRVPMFAIARTKGSVKQHPKMRHWRRKNLKK