Protein Info for MMP_RS00735 in Methanococcus maripaludis S2

Annotation: 5 10-methenyltetrahydromethanopterin hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF22616: HMD_N" amino acids 1 to 239 (239 residues), 467 bits, see alignment E=1.1e-144 TIGR01723: 5,10-methenyltetrahydromethanopterin hydrogenase" amino acids 1 to 341 (341 residues), 570.9 bits, see alignment E=4.5e-176 PF03201: HMD" amino acids 243 to 339 (97 residues), 116.8 bits, see alignment E=4.2e-38

Best Hits

Swiss-Prot: 100% identical to HMD_METMP: 5,10-methenyltetrahydromethanopterin hydrogenase (hmd) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K13942, 5,10-methenyltetrahydromethanopterin hydrogenase [EC: 1.12.98.2] (inferred from 100% identity to mmp:MMP0127)

MetaCyc: 60% identical to Hmd (Methanothermobacter thermautotrophicus)
5,10-methenyltetrahydromethanopterin hydrogenase. [EC: 1.12.98.2]

Predicted SEED Role

"H(2)-dependent N5,N10-methylenetetrahydromethanopterin dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0Z1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>MMP_RS00735 5 10-methenyltetrahydromethanopterin hydrogenase (Methanococcus maripaludis S2)
MKVAILGAGCYRTHAASGITNFSRASQVAKEAGIPEIAMTHSTITMGAELLHLIPEITEV
VVSDPCFAEEPGMVVLDQFDYKAVMEAHLAGDAEKVMPEIREAVKAKAKETPKPPKGCIH
FVHPETVGLKVTASDVEAVKDADIVITWLPKGGSQPAIIEKFASEIKKGAIVTHACTIPT
PKFAKIFKDLGRDDLNIIAYHPGAVPEMKGQAFLSEGLADAEKVEEFYCMAKTARGEAFK
MPANLISPVCDMGSAVTAPVYAAILAYRDAVTQILGAPADFAQMMADEAISQILDLMRNE
GIKNMEDKLNPKALTGTADSMCFGPLADILPASLKVLEKHANENKCECGCSIKP