Protein Info for MMP_RS00715 in Methanococcus maripaludis S2

Annotation: formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF22660: RS_preATP-grasp-like" amino acids 11 to 107 (97 residues), 51.8 bits, see alignment E=2.8e-17 TIGR01142: phosphoribosylglycinamide formyltransferase 2" amino acids 12 to 388 (377 residues), 592.7 bits, see alignment E=1.4e-182 PF02222: ATP-grasp" amino acids 119 to 298 (180 residues), 210.4 bits, see alignment E=5e-66 PF02786: CPSase_L_D2" amino acids 119 to 201 (83 residues), 28.3 bits, see alignment E=3.7e-10 PF07478: Dala_Dala_lig_C" amino acids 131 to 285 (155 residues), 36.4 bits, see alignment E=1.2e-12 PF02655: ATP-grasp_3" amino acids 140 to 283 (144 residues), 24 bits, see alignment E=1.2e-08 PF21244: PurT_C" amino acids 318 to 385 (68 residues), 54.5 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 100% identical to PURT_METMP: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 100% identity to mmp:MMP0123)

MetaCyc: 73% identical to phosphoribosylglycinamide formyltransferase monomer (Methanocaldococcus jannaschii)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 6.3.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0Z5 at UniProt or InterPro

Protein Sequence (388 amino acids)

>MMP_RS00715 formate-dependent phosphoribosylglycinamide formyltransferase (Methanococcus maripaludis S2)
MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAHKYHIIDMK
DAGALRAVIEKEKPDLIVPEIEAINTDTLKEMESEGYHVVPTANATKLTMDREGIRRLAF
EKLGLRTAKYEFAENLEELKEAVTRIGIPCIIKPIMSSSGKGQSTIKSESDIKTAWNYAK
SAARGIGTKVIVEEFIKFDYEITLLTARTAEGTRFCEPIGHIQVDGDYHESWQPHPMCAP
TKAKAQEMAKKITDELGGYGIFGVELFVLDDEVIFSEVSPRPHDTGMVTMVTQKMSEFEI
HARAILGLPVNVDIVSPGASHVIKSEILKWAPEYEIHEASKVKDTKIRLFGKPIAKVGRR
MGVALAVSDDVIKAREHAEKVAHLVKIK