Protein Info for MMP_RS00680 in Methanococcus maripaludis S2

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 3 to 342 (340 residues), 444.9 bits, see alignment E=1e-137 PF01118: Semialdhyde_dh" amino acids 4 to 140 (137 residues), 127.9 bits, see alignment E=4.3e-41 PF22698: Semialdhyde_dhC_1" amino acids 149 to 311 (163 residues), 194.4 bits, see alignment E=2e-61 PF02774: Semialdhyde_dhC" amino acids 159 to 314 (156 residues), 115.4 bits, see alignment E=5.3e-37

Best Hits

Swiss-Prot: 100% identical to ARGC_METMP: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to mmp:MMP0116)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M102 at UniProt or InterPro

Protein Sequence (343 amino acids)

>MMP_RS00680 N-acetyl-gamma-glutamyl-phosphate reductase (Methanococcus maripaludis S2)
MKTVSIIGGTGYTGSELLRLLSNHDEVEVVNVTSRKEAGKNLTDYHPQVRNLSNYNDLKF
QNIAPEDIDSDIVFCATPHGASMAIVPTLHEKGINVIDLSGDYRFEDIDMYESWYGLKHS
GKIDSAVYGLPELHREKIKKSKTIANPGCYPTGAILSMAPLVANDLVEDRIIFDSKSGVS
GAGVEASQTTHFANVNENIGPYKITKHRHSPEIGKELQYLANKNLKVSFTPHLLPVTRGI
LTTAHSFLKEDISPIDVIEIYEEFYKDEFFIRIFEEGMPSLTGVRGTNFCDIGGFEIDQY
GRIVVVSAIDNLVKGASGQAIQNMNIIMGFDEKEGLGVGGLKP