Protein Info for MMP_RS00680 in Methanococcus maripaludis S2

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 3 to 342 (340 residues), 444.9 bits, E=1e-137
• PF01118: Semialdhyde_dh
  • amino acids 4 to 140 (137 residues), 127.9 bits, E=4.2e-41
• PF22698: Semialdhyde_dhC_1
  • amino acids 149 to 311 (163 residues), 193.9 bits, E=2.8e-61
• PF02774: Semialdhyde_dhC
  • amino acids 159 to 314 (156 residues), 115.4 bits, E=5.3e-37

Best Hits

Swiss-Prot: 100% identical to ARGC_METMP: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to mmp:MMP0116)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

See Q6M102 at UniProt or InterPro

Protein Sequence (343 amino acids)

>MMP_RS00680 N-acetyl-gamma-glutamyl-phosphate reductase (Methanococcus maripaludis S2)
MKTVSIIGGTGYTGSELLRLLSNHDEVEVVNVTSRKEAGKNLTDYHPQVRNLSNYNDLKF
QNIAPEDIDSDIVFCATPHGASMAIVPTLHEKGINVIDLSGDYRFEDIDMYESWYGLKHS
GKIDSAVYGLPELHREKIKKSKTIANPGCYPTGAILSMAPLVANDLVEDRIIFDSKSGVS
GAGVEASQTTHFANVNENIGPYKITKHRHSPEIGKELQYLANKNLKVSFTPHLLPVTRGI
LTTAHSFLKEDISPIDVIEIYEEFYKDEFFIRIFEEGMPSLTGVRGTNFCDIGGFEIDQY
GRIVVVSAIDNLVKGASGQAIQNMNIIMGFDEKEGLGVGGLKP