Protein Info for MMP_RS00675 in Methanococcus maripaludis S2

Annotation: nitroreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 5 to 59 (55 residues), 51.6 bits, E=1.3e-17
  • amino acids 62 to 146 (85 residues), 32.9 bits, E=7.4e-12

Best Hits

Swiss-Prot: 47% identical to Y120_METTH: Putative NADH dehydrogenase/NAD(P)H nitroreductase (MTH_120) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mmp:MMP0115)

Predicted SEED Role

"NADPH nitroreductase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See Q6M103 at UniProt or InterPro

Protein Sequence (173 amino acids)

>MMP_RS00675 nitroreductase family protein (Methanococcus maripaludis S2)
MNAIFERRSIRHYTSEDVSEEIVDDLLKAAMSAPSACDQRPWDFVVIRDKNTLSGISKIN
RHARMLNEAPVSIVVCGNMDRVNGSCGQFWVQDCAAATENILIEAQDRGIGAVWLGFYPV
DERVEKMRKVLHAPENVVPFSVVALGNPAEKPVPVEKFDRERIHYEKWPTGYL