Protein Info for MMP_RS00555 in Methanococcus maripaludis S2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details PF12832: MFS_1_like" amino acids 8 to 164 (157 residues), 31.9 bits, see alignment E=1.6e-11 PF05977: MFS_3" amino acids 10 to 378 (369 residues), 42 bits, see alignment E=9.4e-15 PF07690: MFS_1" amino acids 11 to 287 (277 residues), 162.9 bits, see alignment E=2.1e-51 amino acids 213 to 377 (165 residues), 71.5 bits, see alignment E=1.3e-23 PF00083: Sugar_tr" amino acids 38 to 185 (148 residues), 42.8 bits, see alignment E=7.1e-15

Best Hits

Swiss-Prot: 54% identical to Y1560_METJA: Uncharacterized MFS-type transporter MJ1560 (MJ1560) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0099)

Predicted SEED Role

"Uncharacterized MFS-type transporter MJ1560"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M119 at UniProt or InterPro

Protein Sequence (383 amino acids)

>MMP_RS00555 MFS transporter (Methanococcus maripaludis S2)
MKEEMKGIYVLWITIFVTMLGIGLISPLLAIFAKSYGLSNFQIGLIFGSFALVRTIFQLP
AGTLSDSYGKKVFLVGGTLLYGVTTLFYGFASGFASILIVRTFTGVFSAFVNPVAGSYIA
QTSPKSKLGEYMGLFNSAISLGFGVGPLLGGLLADMYGFMVPFYVGGLLGIIASIIAYFK
LEDTPKTQEKQKLSWKNLFSLEFLKMRNFSAAFIINIALTISRGAILAYLAIYAYDYGVS
AFKIGVMLAAMNLVLAVTQKMFGRIFDEKGNRIILHGIIIGNLGMFILAMSTSFTTMFIS
LIISSIGASMSTPGINSIAIRDIPDKRQGEAMGLYTASINVGIFFGAVLLGYISDIVGIS
NMYKIGAVFSFLISYIAYIAIKK