Protein Info for MMP_RS00510 in Methanococcus maripaludis S2

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 13 to 173 (161 residues), 94.5 bits, E=1.9e-30
• PF13579: Glyco_trans_4_4
  • amino acids 14 to 157 (144 residues), 31.9 bits, E=4e-11
• PF13477: Glyco_trans_4_2
  • amino acids 17 to 148 (132 residues), 55.1 bits, E=2.4e-18
• PF00534: Glycos_transf_1
  • amino acids 177 to 328 (152 residues), 128.1 bits, E=6.8e-41
• PF13692: Glyco_trans_1_4
  • amino acids 186 to 318 (133 residues), 107.2 bits, E=2.2e-34

Best Hits

Swiss-Prot: 51% identical to Y1178_METJA: Uncharacterized glycosyltransferase MJ1178 (MJ1178) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0090)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See Q6M128 at UniProt or InterPro

Protein Sequence (355 amino acids)

>MMP_RS00510 glycosyltransferase family 4 protein (Methanococcus maripaludis S2)
LKILLPSIYYPFIGGVSIHVENLIKNLNKLDDFEFHILNYNFDESVENSFENVTIHKVPY
FSKLRGPSYILNGYKLGKKIIKNEKIDLIHSHYAAPQGFLGAILGKKCNIPTVLTLHGSD
VLNLSKSSLGKYFFNYAVHNSEKIICVSEFLKHNLKTNFNIDSNVIYNGFDEELFNPSDN
DKNYGLFVGSLVEQKGIFYFLESIKNIDFNFKIIGGGPLYNKILDFIKLNDIKNVELLGP
KTQNEVSEYLKNCSFLVLPSISEGLGMTIIEAFACKKAVIGTNVGGIPELIKDGINGYIV
NPKNTKALEDKINMLVNDKKLRKSLGEKSLDTSKNFSWGLSSKKTYEIYNSLLNR