Protein Info for MMP_RS00470 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01493: GXGXG
  • amino acids 12 to 192 (181 residues), 116 bits, E=8.1e-38

Best Hits

Swiss-Prot: 70% identical to Y1350_METJA: Uncharacterized protein MJ1350 (MJ1350) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0082)

Predicted SEED Role

"Glutamate synthase [NADPH] putative GlxC chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See Q6M136 at UniProt or InterPro

Protein Sequence (256 amino acids)

>MMP_RS00470 hypothetical protein (Methanococcus maripaludis S2)
MKELKIDAKDMDYRELNEKIHEVLDENKDLEKLVLENVLGQRFIGNGVSRKDLTIIVNGV
PGGDLGMFMKGPKVVVNGNADHAPGNTMDEGFVVIHGSSGDVTGHSMRGGKVYVQGNVGY
RSGIHMKEYKYKFPVLVIGGAAKDFLGEYMAGGIILNLNMDQEDSENIEGRMIATGIHGG
VIYVRGIVKSSQLGIAADIKEFTEEDVEKITPYIEEFCAEFGYSNEIKEKLINSKYTKIA
PISSRPFQKLYTPDLR