Protein Info for MMP_RS00465 in Methanococcus maripaludis S2

Annotation: alpha-hydroxy-acid oxidizing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF13237: Fer4_10" amino acids 12 to 59 (48 residues), 26.1 bits, see alignment 2.7e-09 PF01645: Glu_synthase" amino acids 105 to 478 (374 residues), 502.7 bits, see alignment E=2.8e-154 PF03060: NMO" amino acids 313 to 423 (111 residues), 29.6 bits, see alignment E=1.9e-10 PF00478: IMPDH" amino acids 333 to 414 (82 residues), 30.2 bits, see alignment E=9.7e-11 PF04898: Glu_syn_central" amino acids 356 to 486 (131 residues), 32.2 bits, see alignment E=3.2e-11 PF01070: FMN_dh" amino acids 382 to 421 (40 residues), 33.5 bits, see alignment 9.7e-12

Best Hits

Swiss-Prot: 82% identical to AGLUS_METJA: Archaeal glutamate synthase [NADPH] (MJ1351) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0081)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M137 at UniProt or InterPro

Protein Sequence (510 amino acids)

>MMP_RS00465 alpha-hydroxy-acid oxidizing protein (Methanococcus maripaludis S2)
MIPSTVPPKYKVFVDPERCMLCERCTTECSWGVYRRQGNKILTYPNRCGACLRCVSLCPR
DAITVTLNQSCGREHPVWTPEVKQDVVTQAKSGCILLSGMGNAKEYPIYFDKIVLDACQV
TNPSIDPLREPMELRTYVGKKPEKLEFDYVEDEIDGKKVKKAKLKTKIAPNLKLDTPIMI
GHMSYGALSLNAHKAMAKAVKECGTFMGTGEGGLHRDLYGYSDNVITQVASGRFGVNSEY
LNKGAAIEIKIGQGAKPGIGGHLPGEKVSAEVSMTRMIPQGSDAISPAPHHDIYSIEDLA
QLIRSLKEATRWKMPVFVKISAVHNVSAIANGIATSDADAVVIDGFKGGTGAAPKVFRDN
VGIPIEVAIAAVDDRLREQGNRHKISIIASGGIRNSADVFKSIALGADAVYIGTAAMVAM
GCTVCGRCYTGQCAWGIATQKPELVKRLEVDDAARRVANLIHAWTHEIQELLGAAGINSI
ESLRGNRDRLRGVGLSEIELNTLGIKQAGM