Protein Info for MMP_RS00455 in Methanococcus maripaludis S2

Annotation: orotate phosphoribosyltransferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 63 to 175 (113 residues), 59.5 bits, E=1.3e-20

Best Hits

Swiss-Prot: 100% identical to PYREL_METMP: PyrE-like protein (MMP0079) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to mmp:MMP0079)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.10

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

See Q6M139 at UniProt or InterPro

Protein Sequence (205 amino acids)

>MMP_RS00455 orotate phosphoribosyltransferase-like protein (Methanococcus maripaludis S2)
MKKELILKALKLRDMGFPSGDIAEELNISVKTALYLTLNGEELLKAEESPKEDSEKLDIF
LEWDNVRASSRRLRNISKIICDMLSDVEFDGVVGISSGGVPLATLISDELDKNFSIYVPK
KHIHTEKEKTTGFIGQNMSSIVGKDVIIVDDVMTSGNSVKETIKYLKGIANPKKVFVVMD
KSGIDEIEGVSIEHLFRTGVVDIKK