Protein Info for MMP_RS00320 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF05175: MTS" amino acids 11 to 172 (162 residues), 53.2 bits, see alignment E=1.6e-17 PF02384: N6_Mtase" amino acids 14 to 160 (147 residues), 34.5 bits, see alignment E=9e-12 TIGR00537: putative methylase" amino acids 18 to 200 (183 residues), 218.4 bits, see alignment E=2.9e-69 PF06325: PrmA" amino acids 30 to 110 (81 residues), 63 bits, see alignment E=2e-20 PF13489: Methyltransf_23" amino acids 34 to 110 (77 residues), 28.2 bits, see alignment E=8.8e-10 PF01135: PCMT" amino acids 35 to 110 (76 residues), 20.8 bits, see alignment E=1.7e-07 PF03602: Cons_hypoth95" amino acids 35 to 118 (84 residues), 25.9 bits, see alignment E=4.4e-09 PF13847: Methyltransf_31" amino acids 36 to 164 (129 residues), 55.2 bits, see alignment E=4.4e-18 PF09445: Methyltransf_15" amino acids 38 to 102 (65 residues), 26 bits, see alignment E=3.7e-09 PF13649: Methyltransf_25" amino acids 40 to 126 (87 residues), 35 bits, see alignment E=1.1e-11 PF08241: Methyltransf_11" amino acids 41 to 110 (70 residues), 28.3 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 60% identical to Y928_METJA: Putative protein N5-glutamine methyltransferase MJ0928 (MJ0928) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0054)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M163 at UniProt or InterPro

Protein Sequence (202 amino acids)

>MMP_RS00320 class I SAM-dependent methyltransferase (Methanococcus maripaludis S2)
MIEIIEINGIKIKTHPKVYVPAEDSELLIENLVDVKNKTVLDVGTGSGIQAINAVKQGAL
KVIGIDINPYAVDCAKINSELNEIDSKKLFFKTGDLFKNIDEKFDVILFNAPYLPTSDEE
KLEKYLNYAFDGGKDGREVLDKFLDEVANYLKKDGIIQILQSSLTDGNKTIEKMKKLGFV
AKQTGSLKFSFEELQVITGWKK