Protein Info for MMP_RS00300 in Methanococcus maripaludis S2

Annotation: 6 7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 2 to 135 (134 residues), 160.6 bits, E=1.1e-51
• PF00885: DMRL_synthase
  • amino acids 3 to 133 (131 residues), 129.1 bits, E=5.7e-42

Best Hits

Swiss-Prot: 100% identical to RISB_METMP: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 100% identity to mmp:MMP0050)

MetaCyc: 79% identical to 6,7-dimethyl-8-ribityllumazine synthase monomer (Methanocaldococcus jannaschii)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis II (archaea) (8/10 steps found)
• flavin biosynthesis I (bacteria and plants) (6/9 steps found)
• flavin biosynthesis III (fungi) (5/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See P61730 at UniProt or InterPro

Protein Sequence (137 amino acids)

>MMP_RS00300 6 7-dimethyl-8-ribityllumazine synthase (Methanococcus maripaludis S2)
MVNLGFVIAEFNRDLTFMMEKMAEEHAEFLGANVSHKIMVPGSFDMPLAIKTLLQKDDID
AIVTIGCVIEGDTEHDEIVVQNAARKIADLSLDFGKPVALGIAGPGMTRMQAEDRIDYGK
NAVEAAVKMVKRLKEIQ