Protein Info for MMP_RS00270 in Methanococcus maripaludis S2

Annotation: RNase J family beta-CASP ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR00649: beta-CASP ribonuclease, RNase J family" amino acids 3 to 446 (444 residues), 548.2 bits, see alignment E=9e-169 PF00753: Lactamase_B" amino acids 73 to 131 (59 residues), 35.6 bits, see alignment E=1.9e-12 PF12706: Lactamase_B_2" amino acids 73 to 172 (100 residues), 32.5 bits, see alignment E=1.3e-11 PF22505: RNase_J_b_CASP" amino acids 238 to 360 (123 residues), 80.3 bits, see alignment E=2.2e-26 PF07521: RMMBL" amino acids 382 to 427 (46 residues), 41.4 bits, see alignment 2.3e-14

Best Hits

Swiss-Prot: 77% identical to RNJ_METJA: Ribonuclease J (rnj) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07021, (no description) (inferred from 100% identity to mmp:MMP0044)

Predicted SEED Role

"Putative Zn-dependent hydrolase in polyisoprenoid biosynthetic cluster" in subsystem Archaeal lipids

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M173 at UniProt or InterPro

Protein Sequence (448 amino acids)

>MMP_RS00270 RNase J family beta-CASP ribonuclease (Methanococcus maripaludis S2)
LQLEVVAIGGYEEVGRNMTAVNIDGEIIIFDMGVRLDRIMIHEDTDISKMHSLNLIEMGV
IPDDTVMKNIEGEVKAIVLTHGHLDHIGAITKLAHRYNAPIIGTPYTLELVKREILSEKK
FDVRNPLITLENGNKLDLTANITLEFVKITHSIPDAAMAVLHTPYGAVVYGNDFKFDNFP
VVGEKPDYKALKRIGKQGVIAMVSESTRVDFEGKTASEGVAANLLKNDLLGTDNEDNAVV
VTTFSSHIARIKSITDIASKMGRIPVLVGRSMSKYCGIAQDIGLVKFPKETKICWDPSSI
DKTFHQIMKDGKENYLMVVTGHQGEEGAVLSRMATNKTPFRFEKYDQVVFSADVIPNPMN
AAQRYLLEARLNLAGVRLFKGAHVSGHAAKEDHRDILRWLQPEHLIPAHGDFNLTSAYAK
LAEEEGFRLGEDVHLLRNGQSLKFERVI