Protein Info for MMP_RS00265 in Methanococcus maripaludis S2

Annotation: type 2 isopentenyl-diphosphate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02151: isopentenyl-diphosphate delta-isomerase, type 2" amino acids 9 to 345 (337 residues), 368.5 bits, see alignment E=1.4e-114 PF01070: FMN_dh" amino acids 191 to 340 (150 residues), 60.8 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 100% identical to IDI2_METMP: Isopentenyl-diphosphate delta-isomerase (fni) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 100% identity to mmp:MMP0043)

MetaCyc: 67% identical to isopentenyl-diphosphate Delta-isomerase monomer (Methanocaldococcus jannaschii)
Isopentenyl-diphosphate Delta-isomerase. [EC: 5.3.3.2]

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 5.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M174 at UniProt or InterPro

Protein Sequence (355 amino acids)

>MMP_RS00265 type 2 isopentenyl-diphosphate Delta-isomerase (Methanococcus maripaludis S2)
VNNNSIEYRKLEHLIVCDHCDVEYKKGTLLEDVELIHSGISNCDLDDIDTSIEIFGKKLN
APLIVAAITGGHPKAKEVNKNIAIAVEELNLGMGVGSQRAAISKSYLEDTYSVVRDHTSS
LIIGNLGAVNFVEDSWDEEIISKSVEMIDADAMAIHFNPLQEAIQPEGDVNFKGLNILKE
IISNYNKIHGKIPFIAKQVGEGFSKKDAIFLKEIGFDAIDVGGSGGTSWAAVELYRIKDE
EQKNFSNQYFNWGIPTAASILEVNSAFSGPIIATGGIRTGIDIAKSISIGANCCGTALPI
LKAALKSSEAVTTVLERMIKELKTTMFLTGCNNINELKSARYILKGDLKNWKDQI