Protein Info for MMP_RS00250 in Methanococcus maripaludis S2

Annotation: Flp pilus assembly complex ATPase component TadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 PF00437: T2SSE" amino acids 176 to 445 (270 residues), 168.1 bits, see alignment E=1.1e-53

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 100% identity to mmp:MMP0040)

Predicted SEED Role

"secretory protein kinase @ intein-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M177 at UniProt or InterPro

Protein Sequence (549 amino acids)

>MMP_RS00250 Flp pilus assembly complex ATPase component TadA (Methanococcus maripaludis S2)
MGLFDRIQSRDSNPSVAKKNNVSEKVSETPSILDNSEKVKKPEIKVGFSVNERAKQPVEE
FERDSTSSILDKYFVKVDDIDFDVIIEKENGVTLYKIPEITLMNTALAKFSDMDIKTIKA
ELSESTLQKLGQIQGYLKNYSEKNNLHLRDIEILHLSHYFYLIIGKLGLLEIPLNDSKLE
EVMVNGVESPSFVFHRKYQMCETNIRLDRHEATRVVESIAYLAGRTIDSRTPMLDAFLPD
GSRVNATMSDVTLGGNTITIRKFSEDPLTIVDLINFGTFDLELAAFLWQAVEGYFGAKPA
NTLIVGGTGSGKTTTLNVVSMFSMYTDRLVTIEDTPELQVPLTHLIKMITRPGRPGIQGY
EITMDDLIKNSLRMRPDRIFVGEVRGSEAHSLLVAMNTGHDGCSGTLHANSADEALIRLI
NPPMNVPKVMMSSVDFIINQQRIKRNKKTVRRILGVVEIGGSGENITKTELFKYDGISDS
VVKTGICMWEEDVCQIAGITRDELMDDRINRKKVLKYMVNNNINDIRKVGDVLKQYQENP
ENVLKNILE