Protein Info for MMP_RS00185 in Methanococcus maripaludis S2

Annotation: potassium channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 61 to 90 (30 residues), see Phobius details PF07885: Ion_trans_2" amino acids 13 to 83 (71 residues), 56.2 bits, see alignment E=4e-19 PF02254: TrkA_N" amino acids 110 to 227 (118 residues), 102.6 bits, see alignment E=2.6e-33 PF02080: TrkA_C" amino acids 268 to 333 (66 residues), 47.5 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 47% identical to MJK2_METJA: Probable potassium channel protein 2 (MJ1357) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0027)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M190 at UniProt or InterPro

Protein Sequence (335 amino acids)

>MMP_RS00185 potassium channel protein (Methanococcus maripaludis S2)
MESMEKIKIGIFVLFVVIISFSLMFMYIEGWTLLQAIYFSVATISTVGYGDFYPTSELGQ
LLTILFIVFGVSTGLYTLGAFAESFIGGYFKRYNRRIKMKKRIEMLENHYIVCGYGRIGR
VVIDRLRESGLDYVAIDNNSEILQAEFEKDPNFNYIVGDATHDEYLIDAQIDRAKALIST
VSTDSDNVYITLSSKRLNPKLYVVSKADEQVAMDKLLIAGADKVVSPYMIGGLRVAELAM
KPGILDFVSTFMSIAKYEYDEDLEIRKILIGKNSKIRGKTLTESQIRYNSGVTIIGIKKE
NDLLVNPGPEIILEYNDQIYAFGTGEQLDVLESMV