Protein Info for MMP_RS00135 in Methanococcus maripaludis S2

Annotation: DUF2121 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF09894: MJ0548_N" amino acids 1 to 191 (191 residues), 216.1 bits, see alignment E=3.7e-68 PF25274: MJ0548_C" amino acids 196 to 289 (94 residues), 96.1 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 44% identical to Y548_METJA: Uncharacterized protein MJ0548 (MJ0548) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0021)

Predicted SEED Role

"Uncharacterized protein MJ0548"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M196 at UniProt or InterPro

Protein Sequence (291 amino acids)

>MMP_RS00135 DUF2121 domain-containing protein (Methanococcus maripaludis S2)
LSVVIGYYGKNGAVIAGDKRNLLFNGIESNRAKLEEVLYSGEIKNDEELFKKASEFEVTV
HINDTREKVKSLGNLLSGEVVSIGKDSKRRRMYLTKEKCAIIDIENDQITNKSVKTGSGI
VVFGNRYVKHFVESEIKKHVQKLLKMSAREIRDLFEKILKNIENATLSDTFEYYVVEAGE
PEFEKAVNKDLDDLFNYRHDLSIKMAEMQILTMIAEKIVKIGDVGVIKNGTLVLYDEFLA
INKICPEPEIYSEIEITGEFIEGDIITIDNESLKVKRTGSPVAVQKIICKK