Protein Info for MMP_RS00110 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF17833: UPF0113_N" amino acids 4 to 84 (81 residues), 53.1 bits, see alignment E=3.4e-18 PF03657: UPF0113" amino acids 98 to 161 (64 residues), 74.6 bits, see alignment E=6.4e-25

Best Hits

Swiss-Prot: 49% identical to Y1410_METJA: UPF0113 protein MJ1410 (MJ1410) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07565, 60S ribosome subunit biogenesis protein NIP7 (inferred from 100% identity to mmp:MMP0016)

Predicted SEED Role

"UPF0113 protein MJ1410"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M1A1 at UniProt or InterPro

Protein Sequence (163 amino acids)

>MMP_RS00110 hypothetical protein (Methanococcus maripaludis S2)
MKHRKLEESEISAIKAAISRYIGKKAEELDFNNFLVLRGKSKNVVHVSSQVMKSLKNHKD
IYSAGIHIGDLEEISGKEKFLPSLEGITLVSKDIEKNYAVINEKGEGLFLYSRDVFDSSI
IELKGDGKVAVFNENKELLGIGKYNGKLIKNIMDRGWYLRYGG