Protein Info for MMP_RS00060 in Methanococcus maripaludis S2

Annotation: 3-dehydroquinate synthase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01959: DHQS
  • amino acids 2 to 361 (360 residues), 471.9 bits, E=5.5e-146

Best Hits

Swiss-Prot: 100% identical to DHQS_METMP: 3-dehydroquinate synthase (aroB') from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K11646, dehydroquinate synthase II [EC: 1.4.1.-] (inferred from 100% identity to mmp:MMP0006)

MetaCyc: 69% identical to dehydroquinate synthase II (Methanocaldococcus jannaschii)
RXN-10032 [EC: 1.4.1.24]

Predicted SEED Role

"3,7-dideoxy-D-threo-hepto-2, 6-diulosonate synthase (EC 4.2.3.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.-)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• chorismate biosynthesis II (archaea) (12/12 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (7/7 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis I (6/7 steps found)
• 3-dehydroquinate biosynthesis I (1/2 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Cysteine metabolism
• Monoterpenoid biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.- or 1.4.1.24 or 4.2.3.-

Sequence Analysis Tools

See Q6M1B0 at UniProt or InterPro

Protein Sequence (361 amino acids)

>MMP_RS00060 3-dehydroquinate synthase II (Methanococcus maripaludis S2)
MKFGWIKTTGNDLEERMESVKDALESSIPGIIAEKEEISSVRELGNIKIVSDNLDADVVL
INKGEDLEILKSAKLSGKETGVYVVINTKEDEVYATDVSKLDFVDYVVLEGSDWTIIPLE
NIIADLFSEEIKIVSVVTNVKDAEAAYEILEKGVDGVVLIPKDINEVKDFSKLIERMNSE
SVKLDYATVTKIEPVGSGDRVCIDTCSMMEMGEGMLIGSYSRGMFLVHSETVENPYVATR
PFRVNAGPVHAYILCPENKTKYLSDLKAGDKVLVVNKNGETREAIIGRVKIEKRPLFLVE
AEYNGENLRTILQNAETIRLVGEDGKPVSVVDLKVGTKVLIKPDENARHFGMAIKETIIE
K