Protein Info for MMP_RS00040 in Methanococcus maripaludis S2

Annotation: TIGR03576 family pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR03576: pyridoxal phosphate enzyme, MJ0158 family" amino acids 5 to 354 (350 residues), 576.9 bits, see alignment E=7.3e-178 PF00155: Aminotran_1_2" amino acids 78 to 338 (261 residues), 30 bits, see alignment E=4.9e-11 PF03841: SelA" amino acids 195 to 255 (61 residues), 29 bits, see alignment E=8.5e-11 PF22583: UPF0425_C" amino acids 280 to 341 (62 residues), 91.2 bits, see alignment E=4.3e-30

Best Hits

Swiss-Prot: 100% identical to Y002_METMP: UPF0425 pyridoxal phosphate-dependent protein MMP0002 (MMP0002) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to mmp:MMP0002)

Predicted SEED Role

"UPF0425 pyridoxal phosphate-dependent protein MJ0158" in subsystem Selenocysteine metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M1B4 at UniProt or InterPro

Protein Sequence (354 amino acids)

>MMP_RS00040 TIGR03576 family pyridoxal phosphate-dependent enzyme (Methanococcus maripaludis S2)
MDSLLELNRVNTAREIIRKKIQNTGRNSIYDLTGLCGGFEICEENLKLIETYVGPAIFSE
KLNNAGLSHLSGNSKIHNAVCFNRTSSAILSTIMTLSKSFEKLVHYVPEKPAHPSIPRSC
KIFGMEYFESDSLEEILSKIDENSFTAITGATMDHKVVSEEIACKIIDYAKSKNSPVFFD
DASGARLRKLYKESPALEMGADLVVTSMDKLMDGPRAGLLAGDKNLVDKIYSEGLKFGLE
AQAPIMAAVVTALERFDLNNLKDAFERAEKVDLSVFEAEKIEYKKTPTGFIIKNSSEEKL
IETALKLLENYGIVTITAAGMPGASKNIRIDFCSKDAERISDEYVINAVLNSLK