Protein Info for MMP_RS00035 in Methanococcus maripaludis S2

Annotation: DUF2098 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF09871: DUF2098" amino acids 10 to 93 (84 residues), 76.1 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0001)

Predicted SEED Role

"Uncharacterized protein MJ0157"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M1B5 at UniProt or InterPro

Protein Sequence (93 amino acids)

>MMP_RS00035 DUF2098 family protein (Methanococcus maripaludis S2)
MTLDRNGKLIEIGSYVRYINTGTHGTVKAIEPKNDEEWVLLENDIYYRPELLELVERRKI
EKKESEEELIERITNEDIDLEAAENGCGCSGAG