Protein Info for MMJJ_RS09180 in Methanococcus maripaludis JJ

Annotation: aminodeoxychorismate/anthranilate synthase component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 186 (186 residues), 162.4 bits, see alignment E=5.4e-52 PF00117: GATase" amino acids 3 to 174 (172 residues), 178.4 bits, see alignment E=1.3e-56 PF07722: Peptidase_C26" amino acids 69 to 166 (98 residues), 44.5 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 65% identical to TRPG_THEKO: Anthranilate synthase component 2 (trpG) from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 98% identity to mmp:MMP1005)

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>MMJJ_RS09180 aminodeoxychorismate/anthranilate synthase component II (Methanococcus maripaludis JJ)
MIVIIDNKDSFVWNLADYASIYDSVKVVPNTISIDELKKLNPDGIIISPGPGAPENKRDV
ENCPEIIKTMDVPVLGVCLGHQTIAHIFGGKVGRIPPVHGKSSSVTHDSKGIFKNVKNPF
TAGRYHSLSVLKVPENFTVTATTDDGTVMGIRHNDMPIEGVQFHPESVLTEFEEKEGLKI
IENFVKFAKTYKSFKKEI