Protein Info for MMJJ_RS09170 in Methanococcus maripaludis JJ

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 2 to 59 (58 residues), 60 bits, E=1.5e-20
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 2 to 319 (318 residues), 373.2 bits, E=6.4e-116
• PF00591: Glycos_transf_3
  • amino acids 66 to 310 (245 residues), 250.2 bits, E=2.6e-78

Best Hits

Swiss-Prot: 98% identical to TRPD_METMP: Anthranilate phosphoribosyltransferase (trpD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 98% identity to mmp:MMP1007)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Protein Sequence (321 amino acids)

>MMJJ_RS09170 anthranilate phosphoribosyltransferase (Methanococcus maripaludis JJ)
MLNKLIERENLSFEESYELFNMLLNESEMRIAAYLVALQTKGLTADEIAGFAKAMRDNAV
KIDLGEVTDTCGTGGDGSKTINVSTAVSIILSCFTKVAKHGNVSITSNSGSANVYEALGC
KIPETPEDAKKSMDKTNFAFLFAQKYHPALKKIMPVRNELKVKTIFNILGPLANPANPKY
QILGVNSSELCDNVAIALSKVGGIKKALVVYGNGLDELTPNGTSKITEYDGKFDTYEVTP
KDFGLNYSKIIPCESPDESAKRLIDVFSGKINEDRNFILMNAAAALYTSEIASDFLDGVE
IAKEAIESGKVLKKLEEIRNV