Protein Info for MMJJ_RS09165 in Methanococcus maripaludis JJ

Annotation: indole-3-glycerol phosphate synthase TrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00218: IGPS" amino acids 13 to 224 (212 residues), 182.8 bits, see alignment E=3.5e-58

Best Hits

Swiss-Prot: 70% identical to TRPC_PYRAB: Indole-3-glycerol phosphate synthase (trpC) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K01609, indole-3-glycerol phosphate synthase [EC: 4.1.1.48] (inferred from 100% identity to mmp:MMP1008)

MetaCyc: 65% identical to indole-3-glycerol phosphate synthase (Thermococcus kodakarensis)
Indole-3-glycerol-phosphate synthase. [EC: 4.1.1.48]

Predicted SEED Role

"Indole-3-glycerol phosphate synthase (EC 4.1.1.48)" in subsystem Tryptophan synthesis (EC 4.1.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>MMJJ_RS09165 indole-3-glycerol phosphate synthase TrpC (Methanococcus maripaludis JJ)
MTINFKKQANAIKNFDKNPIIAEIKVHSPKYGDLLKGRSEMDILRIYEEAGAVGISYITD
KQHFNGNFDMFKKICENTELPVLRKDFLTTKDEIEKTASAGASTVLIIARLLKEKTAEFV
DFALECGLDTLVEVHNTEEIEIAKSTNTTMIGINNRDISKLELDDGTVSLTENLADLIPK
DRILVSESGIANLTDLKTALKYADAALIGTSFMTAENQNEFVKSFVEGK