Protein Info for MMJJ_RS09160 in Methanococcus maripaludis JJ

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00857: dihydroorotase, multifunctional complex type
  • amino acids 13 to 416 (404 residues), 442.3 bits, E=9.3e-137
• PF01979: Amidohydro_1
  • amino acids 47 to 415 (369 residues), 65 bits, E=7.8e-22

Best Hits

Swiss-Prot: 62% identical to PYRC_METJA: Dihydroorotase (pyrC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 94% identity to mmp:MMP1009)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.3

Protein Sequence (418 amino acids)

>MMJJ_RS09160 dihydroorotase (Methanococcus maripaludis JJ)
MVLLKNGKIVSENKITESDILIEDGIIQKIEKNIDYSGEIIDLKGNYVFPGIIDSHVHFR
WGNPEKEDFVSGSEAAIAGGIVYAIDMPNNTPPVTTKDIFYKKMKEGNEQSKINLYFAYG
VTENNYLENVEEAIFYKIFMVKSVGDLFISDYSKLREILDQNKIFAIHAEHKSIISENSK
KYELNSFENHCKIRSRESEIEAVREVLNVLQKIDKESKNKPHVHFCHISVKEALDLIKNA
KKTFKNVKVTVEVSPHHLFLNSKMAEDLKGCGKFNPPLREEADNLALLNGIIDGTVDIVA
TDHAPHLIDEKLNLVENCPSGIPGIETLVPLIMNLVNEEKISIFDAYRVLSRNPSEIFKI
NNKIKVGNNANMTVVDMDKEYKISAKDFKSKAKFTPFEGKTVKGKPSATLVNGKIYIL