Protein Info for MMJJ_RS09120 in Methanococcus maripaludis JJ

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 1 to 287 (287 residues), 187 bits, E=6.8e-59
• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 463 (463 residues), 473.8 bits, E=4.7e-146
• TIGR00657: aspartate kinase
  • amino acids 2 to 462 (461 residues), 477.4 bits, E=5e-147
• PF13840: ACT_7
  • amino acids 396 to 459 (64 residues), 29 bits, E=1.2e-10

Best Hits

Swiss-Prot: 67% identical to AK_METJA: Probable aspartokinase (MJ0571) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 99% identity to mmp:MMP1017)

MetaCyc: 67% identical to aspartate kinase monomer (Methanocaldococcus jannaschii)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• chorismate biosynthesis II (archaea) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (7/7 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-methionine biosynthesis IV (3/4 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• aspartate superpathway (18/25 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (7/12 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (3/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (468 amino acids)

>MMJJ_RS09120 aspartate kinase (Methanococcus maripaludis JJ)
MVTVMKFGGTSVGNGDRIRNVAKIVVNKTNEDNDVVVVTSAMTQVTNSLVEISAQALDVR
DIAKINNFIEDLRRKHEIAIEQAIENHEIRVEVSKTIESSINELEKVLVGVSYLGELTPK
SKDFILSFGERLSAPILSGAIRDMGKHSLYLAGRDAGIITDDNFTCAKVLRLEVSEKIKP
LLKDGFIPVVTGFVAGTEDGHITTLGRGGSDYSAALVGLGLTADMVEIWTDVSGVLSADP
RMVENVKQIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKIPLRIKNTFEPENKGTLITD
SSETSNGIIKAITTIKDVILINIFGGGMVGVSGTAARIFNVLGKSNANVILITQGSSETN
ISIVIYDGELEAKKCVRELRDEFGECHLIKDITFDKEVCVVSVVGSGMKGAKGIAGKLFD
AVSESGANIKMIAQGSSETNISFVINDDKLESCLKTLHKTFVEDEINF