Protein Info for MMJJ_RS09105 in Methanococcus maripaludis JJ

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 208 to 238 (31 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 279 to 309 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 4 to 311 (308 residues), 183.7 bits, see alignment E=3e-58

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP1020)

Predicted SEED Role

"UPF0118 membrane protein MJ1177"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>MMJJ_RS09105 AI-2E family transporter (Methanococcus maripaludis JJ)
MVFSFFALIYMLWPFMGIIALAVAVAYMTKPLYDILKPKFGRTYGAIICLLGIVIPSLLL
VVLVAEDVVTFLLSLDIENIITKVTPILNDIGYLRVDGPDVSKPFSDIWSVSKPLLNSFA
SQISSIPSLLMKLLFLSFMTFYFLKDGDKLTDSFLIYVPDDKKRNTALFLSEIHKALKTL
FIGNAVTSVIVGIISIIGYWLIGIPNPITLGALSGILNILPVVGGWTIYVPLTVYYLLTG
EIAKGILLGLFGIVFLSLAPDFAIRPRVISKDGDLHPALVLIAFLIGPLVFGIPGLAIGP
IIVSTVYAIHKVRRLIEKKNN