Protein Info for MMJJ_RS08920 in Methanococcus maripaludis JJ

Annotation: CoB--CoM heterodisulfide reductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR03288: CoB--CoM heterodisulfide reductase, subunit B" amino acids 2 to 291 (290 residues), 512.3 bits, see alignment E=1.8e-158 PF02754: CCG" amino acids 3 to 85 (83 residues), 66.1 bits, see alignment E=1.2e-22 amino acids 148 to 239 (92 residues), 66.1 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 99% identical to HDRB2_METMP: H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit B2 (hdrB2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03389, heterodisulfide reductase subunit B [EC: 1.8.98.1] (inferred from 99% identity to mmp:MMP1053)

MetaCyc: 62% identical to H(2):CoB-CoM heterodisulfide,ferredoxin reductase beta component monomer (Methanothermobacter thermautotrophicus)
RXN-18521 [EC: 1.8.98.5]

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit B (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1 or 1.8.98.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>MMJJ_RS08920 CoB--CoM heterodisulfide reductase subunit B (Methanococcus maripaludis JJ)
MKYAFFLGCIMPNRYAGVESATRTVMEKLGVELVDMPGASCCPAPGVFGSFDQKTWLTLA
ARNLVIAEEMGTDIVTVCNGCYGSLYEAAHMLHENKEALAMVNEQLKEIGKEYKGTVHVR
HFAELIYKEIGVDKIRENVVKPLNVNIGVHYGCHFLKPTAAKGLGNAEHPTMLDELVEAT
GAKSVDYKDKMMCCGAGGGVRAKELDLALSMTQEKIENMLAVGADATVNVCPFCQLQFDR
GQVEIKEKLGNEYNFPVVHLSQLLGLAMGMQPNEVALDVNFISPEPLLQKLGY