Protein Info for MMJJ_RS08905 in Methanococcus maripaludis JJ

Annotation: YcaO-related McrA-glycine thioamidation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR03266: putative methanogenesis marker protein 1" amino acids 12 to 384 (373 residues), 586.2 bits, see alignment E=2.6e-180 TIGR00702: YcaO-type kinase domain" amino acids 15 to 382 (368 residues), 382.7 bits, see alignment E=1.9e-118 PF02624: YcaO" amino acids 66 to 372 (307 residues), 276.4 bits, see alignment E=1.8e-86

Best Hits

Swiss-Prot: 56% identical to Y1094_METJA: Uncharacterized protein MJ1094 (MJ1094) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09136, ribosomal protein S12 methylthiotransferase (inferred from 96% identity to mmp:MMP1056)

Predicted SEED Role

"SagD family docking scaffold"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>MMJJ_RS08905 YcaO-related McrA-glycine thioamidation protein (Methanococcus maripaludis JJ)
MEDDINYTLAAYRICTPEETFEKIEPIIKEIGVTRTARIDGLDRIGIPVFSSIRPSAKDG
AISVYAGKGATEIQAKVSSTMEAIERYSAEFDENSKLELIKEPENPINLDDLILPGGKRA
EYSDTDGIEWVSGTDIISGKTFDVPINSAVHPYDGKKLFRSNTNGLASGNSEEEAIFHGM
LEVIERDAWSISELSKNTYRKVNVENAKNPLIFELLKKFEKAKINIILKDLTSEVGIPTV
AAISDDDVLKDPALLCMGVGCHLHPEIAVLRALTEVAQSRATQIHGAREDTNRGDVVRRI
SYDRMKRVHKKWYTFKNEINIEDMPDNAKLNLKKDIETVKHILKQNGFDKIITVKLNKTD
IDVSRVIIPKMEMYSVDRDRISLWIKDRIRRNLESNLNLI