Protein Info for MMJJ_RS08890 in Methanococcus maripaludis JJ

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details PF01946: Thi4" amino acids 6 to 39 (34 residues), 27.3 bits, see alignment (E = 1e-09) PF01494: FAD_binding_3" amino acids 8 to 41 (34 residues), 24.1 bits, see alignment (E = 9.9e-09) PF07992: Pyr_redox_2" amino acids 8 to 53 (46 residues), 27.8 bits, see alignment 8.9e-10 PF00890: FAD_binding_2" amino acids 9 to 41 (33 residues), 24.2 bits, see alignment (E = 9.4e-09) PF13450: NAD_binding_8" amino acids 12 to 42 (31 residues), 25.2 bits, see alignment (E = 8.2e-09) PF21688: FAD-depend_C" amino acids 231 to 411 (181 residues), 40.7 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K07137, (no description) (inferred from 96% identity to mmp:MMP1059)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>MMJJ_RS08890 NAD(P)/FAD-dependent oxidoreductase (Methanococcus maripaludis JJ)
MENLKNYFDVIIIGAGPAGLFAAYELSKYGNLKTLVIDRGKDVLERQCAAEKLKKCIKCN
PCQIMYGVGGAGGLSDGTLNLRPDIGGNLVEITNDENYAWQLIFEVDKIFLEHAGPKKLF
KGSFEKIKGLQRRSAQNGVRFIPIIQRHIGSDHTKQLINNIKITLQNRGVEFLLNTEVFK
FEKNKVFANISGKEEKINAKYIIVAPGRGNAEWFLKISEKIGLISNHGPIDVGVRVEVPS
IIMESITEINHDPKFHIYTDTYDDFVRTFCTNPYGFVVEENYGDIIGVNGHSMVDKKSEN
TNFSFLTRIELTEPVENTTSYGKSIAKLTTTLGGGKPILQRLGDLKRGRRSTWDRLKKSS
FDPTLKQVTPGDIAMALPHRIVTNIIEGLEKLDKVIPGVSNDHTLLYAPEIKYYAMKTKV
NDDLETSVSNIFAAGDGAGLSRDITNSCATGILAARGILKKEGITDIFKDENTNWQEQIE
TMK