Protein Info for MMJJ_RS08865 in Methanococcus maripaludis JJ

Annotation: class IV adenylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00318: putative adenylyl cyclase CyaB
  • amino acids 1 to 180 (180 residues), 170.3 bits, E=1.8e-54
• PF01928: CYTH
  • amino acids 1 to 177 (177 residues), 114.9 bits, E=2e-37

Best Hits

Swiss-Prot: 54% identical to Y240_METJA: Putative adenylate cyclase MJ0240 (MJ0240) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K05873, adenylate cyclase, class 2 [EC: 4.6.1.1] (inferred from 97% identity to mmp:MMP1064)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Protein Sequence (187 amino acids)

>MMJJ_RS08865 class IV adenylate cyclase (Methanococcus maripaludis JJ)
MIEVEIKVSLKDEDSKKILEKLKSLGFEKEETKEQVDTYFNGIDRDFQVTDEALRIRKSL
NLDSNKGTIYVTYKGKKLDSISKTREEIEVEILDMDLMYNIFEKLGFKPVHPIRKIRKIY
KKEDIEVSFDTVDCVGDYLEIEKVVDDDSKREQALLELLDLLKSLNISNDKLEKRSYLEL
WRGNCGK