Protein Info for MMJJ_RS08820 in Methanococcus maripaludis JJ
Annotation: pyridoxal phosphate-dependent aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to AAT_METJA: Probable aspartate aminotransferase (MJ0001) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00812, aspartate aminotransferase [EC: 2.6.1.1] (inferred from 96% identity to mmz:MmarC7_0325)Predicted SEED Role
"Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57) @ Aspartate aminotransferase (EC 2.6.1.1)" (EC 2.6.1.1, EC 2.6.1.57)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (12/13 steps found)
- superpathway of L-phenylalanine biosynthesis (9/10 steps found)
- superpathway of L-tyrosine biosynthesis (9/10 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-aspartate biosynthesis (1/1 steps found)
- L-aspartate degradation I (1/1 steps found)
- aspartate superpathway (18/25 steps found)
- (R)-cysteate degradation (2/3 steps found)
- L-asparagine degradation III (mammalian) (2/3 steps found)
- TCA cycle VIII (Chlamydia) (4/6 steps found)
- L-glutamate degradation II (1/2 steps found)
- L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
- superpathway of L-aspartate and L-asparagine biosynthesis (2/4 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
- L-phenylalanine degradation II (anaerobic) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
- sulfolactate degradation III (1/3 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (7/12 steps found)
- L-phenylalanine degradation III (1/4 steps found)
- L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
- L-tyrosine degradation III (1/4 steps found)
- coenzyme M biosynthesis II (2/6 steps found)
- superpathway of sulfolactate degradation (2/6 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation I (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (4/11 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
- (S)-reticuline biosynthesis I (2/11 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
- indole-3-acetate biosynthesis II (2/12 steps found)
- tropane alkaloids biosynthesis (1/11 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (3/14 steps found)
- superpathway of rosmarinic acid biosynthesis (1/14 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (2/16 steps found)
- superpathway of chorismate metabolism (25/59 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine metabolism
- Glutamate metabolism
- Lysine biosynthesis
- Methionine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.1, 2.6.1.57
Use Curated BLAST to search for 2.6.1.1 or 2.6.1.57
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (375 amino acids)
>MMJJ_RS08820 pyridoxal phosphate-dependent aminotransferase (Methanococcus maripaludis JJ) MIAERCLRTEQSEIRKIFNMATENSINLGIGEPDFDTPKHIVEAAKLALDAGKTHYVPNA GIPELTSAISEKLKKDNNLDVSQKNIVTTCGASEALMLSLFTLVNRGEEVLIPDPGFVSY KGLTELCEGKMVPIDLDDKFRIDLESVKNSISEKTKCIVLNSPSNPTGSVMTKEEIKGIC EIAEEKNICVISDEIYEKIIYGKKHYSAMEFTENCILINGFSKAYSMTGWRVGYLAVNEN FDKKYQILENMMKIHQYGFACATSFAQFGAVEALNGDQVCVSEMVAEFERRRDLIYSGMK EIFSVQKPEGAFYIFPDVSEYGNGMDVAKKLIQNGILCVPGSAFGKNGENSVRFSYATKY EDIKRALEIMKNVLL