Protein Info for MMJJ_RS08795 in Methanococcus maripaludis JJ

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03990: phosphoglucosamine mutase
  • amino acids 1 to 440 (440 residues), 536.4 bits, E=2.8e-165
• PF02878: PGM_PMM_I
  • amino acids 2 to 125 (124 residues), 124.8 bits, E=4.1e-40
• PF02879: PGM_PMM_II
  • amino acids 144 to 244 (101 residues), 71.6 bits, E=1.4e-23
• PF02880: PGM_PMM_III
  • amino acids 250 to 356 (107 residues), 95.5 bits, E=4.8e-31
• PF00408: PGM_PMM_IV
  • amino acids 389 to 432 (44 residues), 43 bits, 7.8e-15

Best Hits

Swiss-Prot: 96% identical to GLMM_METMP: Phosphoglucosamine mutase (glmM) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 96% identity to mmp:MMP1077)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• GDP-mannose biosynthesis (2/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (1/3 steps found)
• GDP-α-D-glucose biosynthesis (1/3 steps found)
• trehalose degradation V (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (2/5 steps found)
• glucose and glucose-1-phosphate degradation (2/5 steps found)
• superpathway of anaerobic sucrose degradation (12/19 steps found)
• glycogen degradation I (4/8 steps found)
• sucrose biosynthesis II (4/8 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• chitin biosynthesis (4/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glucosylglycerol biosynthesis (1/5 steps found)
• β-(1,4)-mannan degradation (1/7 steps found)
• starch biosynthesis (3/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (4/14 steps found)
• peptidoglycan recycling I (3/14 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (2/19 steps found)
• streptomycin biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Protein Sequence (447 amino acids)

>MMJJ_RS08795 phosphoglucosamine mutase (Methanococcus maripaludis JJ)
MKLFGTSGIRMKNLDPLIAYKVGFAISKNFKKAVIGRDTRTTGNLIESAITAGLLNGGCD
VTTIGMVPTPVLGYSAKDYDLGIMITASHNPPEYNGIKLFNKNGTAFDLMQEKKLEDIIN
NDDFNEGTWDNIGCILEDKTAVKKYSEYILQSLNINTNFNVVVDCANAAGCVVSPTIFTE
AGCKVISVNSHCDGRFVGRMPEPNETNLKETVDIIKGLNSNGRNYIGIAHDGDADRMIAI
DELGRVTDFDKLLAAFCKYLVQKTGADKIVTTVDASMAIEEYLNEFGAKVIRTKIGDVAV
AEELEKTGAIFGGEPSGTWIHRDIHLTPDGILSGLRVLEMMEFYGKKLHEIIDEVPSYYN
MREKISCQDNLKQEVMDYISKEGEKIFETKPETLDGVRFSFEKGWILIRPSGTESYVRVR
VEAKEKDFAEKLMKTGISMVKTGISGN