Protein Info for MMJJ_RS08785 in Methanococcus maripaludis JJ

Annotation: D-sedoheptulose 7-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF13580: SIS_2" amino acids 4 to 140 (137 residues), 109.5 bits, see alignment E=1.4e-35 TIGR00441: phosphoheptose isomerase" amino acids 28 to 180 (153 residues), 238.9 bits, see alignment E=1.2e-75

Best Hits

Swiss-Prot: 77% identical to GMHA_METJA: Probable phosphoheptose isomerase (gmhA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 82% identity to mfs:MFS40622_0411)

MetaCyc: 48% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>MMJJ_RS08785 D-sedoheptulose 7-phosphate isomerase (Methanococcus maripaludis JJ)
MKTYFEESSKVKLDFISKNEHKLIDAINIIVNALKNGNKILICGNGGSAADSQHFAAEIV
GRYKLKRKGYPAIALSTDTSILTAIGNDYGFEKIFERQVEALGTVGDILIGISTSGNSEN
VINAVNLAKNKGLYTIGLLGKDGGKLNNLVDIPLIVPSNNTPRVQECHLTIYHVICEEVE
KKLM