Protein Info for MMJJ_RS08775 in Methanococcus maripaludis JJ

Annotation: PfkB family carbohydrate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00294: PfkB" amino acids 2 to 294 (293 residues), 118 bits, see alignment E=5.7e-38 PF08543: Phos_pyr_kin" amino acids 177 to 281 (105 residues), 40.2 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 69% identity to mig:Metig_0252)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MMJJ_RS08775 PfkB family carbohydrate kinase (Methanococcus maripaludis JJ)
MITVLGDVMLDKYTYGKVERINPEAPVPILNVLNKKYAIGGAGNVANNIAFLKHPVLLIS
SANLNDEFGKKIAEICDENCITYKFVSDGRPTILKHRFVAVGYNQQLLRADYEEKKAFSN
SIINEIISNFKNLNDSSVLIISDYNKGLLTQNLISELKQEFKGKILVDPKPENINMYNDV
YLIKPNLFEASKILGREIINNDDSVESAGLELVERFNSNFVITRSEKGVSVFTKDRKIEH
ICGKVRDVHDVSGAGDTFIATLAYAIDKGYELIDAVKLANRASSIVVSKSGTATVTLEEL
FGDTHE