Protein Info for MMJJ_RS08770 in Methanococcus maripaludis JJ

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 3 to 142 (140 residues), 126.5 bits, see alignment E=1.2e-40 TIGR01662: HAD hydrolase, family IIIA" amino acids 3 to 140 (138 residues), 104.2 bits, see alignment E=9.4e-34 PF08645: PNK3P" amino acids 10 to 126 (117 residues), 38.4 bits, see alignment E=2.2e-13 PF00702: Hydrolase" amino acids 18 to 135 (118 residues), 32.9 bits, see alignment E=1.8e-11 PF13419: HAD_2" amino acids 21 to 141 (121 residues), 46.9 bits, see alignment E=6.6e-16 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 51 to 135 (85 residues), 24.7 bits, see alignment E=3.9e-09 PF13242: Hydrolase_like" amino acids 96 to 141 (46 residues), 44.2 bits, see alignment E=2.9e-15

Best Hits

Swiss-Prot: 41% identical to GMHBB_PASMU: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pasteurella multocida (strain Pm70)

KEGG orthology group: None (inferred from 68% identity to mok:Metok_0040)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>MMJJ_RS08770 HAD family hydrolase (Methanococcus maripaludis JJ)
MSKTVFLDRDGVINKKLENDYVKSISEFEILEGVKIALQKLKELGYLLVVITNQQGIGKG
IMSEKDLLKVHEHMLKELPEIDDIFYCPHLNGTCNCRKPENKMLYDAKEKLDIDFNKSWM
IGDSKSDILCGKSVGCKTIMICDNLKQHFGDFMGKNLVECVEIIEKNR