Protein Info for MMJJ_RS08725 in Methanococcus maripaludis JJ

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 87 to 116 (30 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details amino acids 466 to 491 (26 residues), see Phobius details PF01943: Polysacc_synt" amino acids 7 to 301 (295 residues), 135.8 bits, see alignment E=4.2e-43 PF13440: Polysacc_synt_3" amino acids 42 to 351 (310 residues), 35.4 bits, see alignment E=1.4e-12 PF01554: MatE" amino acids 240 to 399 (160 residues), 27.5 bits, see alignment E=4.9e-10 PF14667: Polysacc_synt_C" amino acids 353 to 489 (137 residues), 79.8 bits, see alignment E=4.6e-26

Best Hits

Swiss-Prot: 57% identical to Y1068_METJA: Uncharacterized membrane protein MJ1068 (MJ1068) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 73% identity to mfs:MFS40622_0403)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>MMJJ_RS08725 flippase (Methanococcus maripaludis JJ)
MSYKERVLKGVSWNFLLLLAAAPIGYFVRILYSNEIPKLDVGLFYAVFDFCCMIAIFKNL
GLNAALVRFIPKYLHEKRLDLVKSSIICAGVLQTTVSLIMTLLIILLSSFIATYYINNQG
QFTGQLDLVICVLIILSIGYWFQSIMDVVANSIWGFQNQKYYGTINFVKIFMVLIISFIL
IHVFDVRTVFTPICAYTLAPILMIFIYTYIFIKKIFPEFFIEKFSFSKKLTKDLFSYGLP
LMMGSAGALVLNYIDGICLTYFAGLNAVADYRNVAMPTVSILRYFATAVGAVLFPMSSEL
WEMGHGGILGKSVEKICLYSFVAVFPITVLTAYFPEVIVNLFFNTQYLPAADAIRILSLG
TIFFTLNSIGFNVLNGIGKSLLSTKIIYFGAIFNLIFNILLIPKFGIVGASATTVLGYLL
MWILQARYLGDFINYSNMLKKWLITTLLGVFSLIPLIFVTKIINNIILQLSVGMAVYLGV
YALGIILFKIIEIEKLKEMFRIGI