Protein Info for MMJJ_RS08720 in Methanococcus maripaludis JJ

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 175 (175 residues), 204.5 bits, see alignment E=2.4e-64 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 420 (420 residues), 414.9 bits, see alignment E=1.6e-128 PF00984: UDPG_MGDP_dh" amino acids 196 to 288 (93 residues), 119.5 bits, see alignment E=1.1e-38 PF03720: UDPG_MGDP_dh_C" amino acids 311 to 423 (113 residues), 78 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 77% identity to mvn:Mevan_0413)

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>MMJJ_RS08720 UDP-glucose/GDP-mannose dehydrogenase family protein (Methanococcus maripaludis JJ)
MKISVIGTGYVGLIQAVGLASFGFDVTGIDIDESKVKMLNNGVCPLYEDGLEKLLKKHVG
NNLKFTTSYEETIDSDVIFLCVGTPQDKEGNTDLKYIFSAVEMLKKHFQSQKWLVIKSTV
PIGTNRLLKERLTGYDIEIISNPEFLKEGVALKEFLNPERIVLGFDENDSSSKEILEKIY
KNFKEKNIPFILTNYETSEMIKYASNAFLATKISFINELSKLADKTNADIKTVAYSMGLD
DRIGKKFLNAGIGYGGSCFPKDVKSLIKQFEYNGVVPKIITATNSVNENQIKWFFGKIKN
YYGNINGKTFAILGLAFKPDTDDLRESAGIKLIDLLLCEGAIIKGYDYIKQARENACNIY
KSNASKPFHGSNFYVLDNLYDTVSNVDGIIITVEDNKLNYEDWSNIFNLASEKIIFDGKN
ILHKEKVEKFGFEYFGVGLK