Protein Info for MMJJ_RS08710 in Methanococcus maripaludis JJ

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 2 to 260 (259 residues), 360.6 bits, E=2.6e-112
• PF00483: NTP_transferase
  • amino acids 4 to 263 (260 residues), 130.7 bits, E=7e-42
• PF12804: NTP_transf_3
  • amino acids 5 to 157 (153 residues), 38 bits, E=2e-13

Best Hits

Swiss-Prot: 68% identical to Y1334_METJA: Putative UTP--glucose-1-phosphate uridylyltransferase (MJ1334) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 95% identity to mmp:MMP1091)

MetaCyc: 44% identical to UTP-glucose-1-phosphate uridylyltransferase (Bacillus subtilis subtilis 168)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• superpathway of anaerobic sucrose degradation (12/19 steps found)
• sucrose biosynthesis II (4/8 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• stachyose degradation (2/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (3/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Protein Sequence (282 amino acids)

>MMJJ_RS08710 UTP--glucose-1-phosphate uridylyltransferase GalU (Methanococcus maripaludis JJ)
MIKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLANAGIEDILVITGRGKY
AIENHFDKNFELEERLKKDGKCEPLKKILDINEFANIYYTRQGKQNGLGDAVHCGKEFIC
EDYTIVMVGDTIYSGNVPKKLIEAHEKYGCSVIALERVPKEDVHKYGVISGKELESGIFE
INDLVEKPNVEDAPSNLIITGAYLLSSKIFDHIENTKPGRGGEIQLTDAMKTLLKEEKII
GLEVDFKRYDIGDIKGWLEANVELGIEHIDGFKEYIKDLCDD