Protein Info for MMJJ_RS08600 in Methanococcus maripaludis JJ

Annotation: transketolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02779: Transket_pyr" amino acids 7 to 169 (163 residues), 165.6 bits, see alignment E=1.4e-52 PF02780: Transketolase_C" amino acids 184 to 302 (119 residues), 106 bits, see alignment E=2e-34 PF22613: Transketolase_C_1" amino acids 191 to 297 (107 residues), 31.8 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 70% identical to TKTC_METJA: Putative transketolase C-terminal section (MJ0679) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 98% identity to mmp:MMP1113)

Predicted SEED Role

"Transketolase, C-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MMJJ_RS08600 transketolase family protein (Methanococcus maripaludis JJ)
MKGTKKGMREAYGETLAELGEVNENIVVLDADLSGSTKTGIFAKKYPERFFNAGIAEQNM
MGMAAGLSRTGKTVFASTFAMFATGRAWEQIRNSIAYPGLNVKICATHSGVTVGEDGASH
EMTEDIAIMRAIPKMIVISPSDYLETKNAVRWAANYEGPVYVRMPRGNTEIIFENEEEAK
FEFGKARILKEGTDITLIATGELVPEALNASKILSEKGISAQVIAIATIKPIDKDAIKNS
KDFIVSIEDHSIIGGLGGAISEVIAEEGLNKKLLRVGINDEFGKSGKAGDLLKYYKLDSE
SIAETVMNAYKK