Protein Info for MMJJ_RS08455 in Methanococcus maripaludis JJ

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12895: ANAPC3" amino acids 25 to 85 (61 residues), 33.9 bits, see alignment E=1.4e-11 PF07719: TPR_2" amino acids 28 to 60 (33 residues), 30.6 bits, see alignment E=9.7e-11 PF00515: TPR_1" amino acids 29 to 60 (32 residues), 28.9 bits, see alignment E=3.4e-10 PF13181: TPR_8" amino acids 31 to 60 (30 residues), 19.9 bits, see alignment 2.8e-07 amino acids 63 to 86 (24 residues), 19.7 bits, see alignment 3.2e-07 PF13432: TPR_16" amino acids 32 to 86 (55 residues), 34.7 bits, see alignment E=9.2e-12 PF14559: TPR_19" amino acids 40 to 105 (66 residues), 28.5 bits, see alignment E=7.1e-10 PF13431: TPR_17" amino acids 50 to 82 (33 residues), 24 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: None (inferred from 94% identity to mmp:MMP1143)

Predicted SEED Role

"TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>MMJJ_RS08455 tetratricopeptide repeat protein (Methanococcus maripaludis JJ)
MRDILKKELILLGILISIVFAGCVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPE
ESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEYNKDVWAAKADALRYIEGKEVEAEI
AEARAK