Protein Info for MMJJ_RS08440 in Methanococcus maripaludis JJ

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01134: amidophosphoribosyltransferase
  • amino acids 2 to 445 (444 residues), 547.7 bits, E=1.4e-168
• PF13230: GATase_4
  • amino acids 65 to 145 (81 residues), 30.9 bits, E=2.8e-11
• PF13522: GATase_6
  • amino acids 67 to 198 (132 residues), 80.8 bits, E=1.8e-26
• PF13537: GATase_7
  • amino acids 83 to 202 (120 residues), 83.2 bits, E=3e-27

Best Hits

Swiss-Prot: 54% identical to PUR1_METTH: Amidophosphoribosyltransferase (purF) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 99% identity to mmp:MMP1146)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Protein Sequence (459 amino acids)

>MMJJ_RS08440 amidophosphoribosyltransferase (Methanococcus maripaludis JJ)
MCGIFGIYSHEKSNIVKKVYYGLYALQHRGQEGAGIAVGNGKEIGFYKGLGLVPEVFSNK
ELQNLYGHIGVGHVRYSTTGRNTIENCQPFVVNSSFGKIAITHNGDIVNSKELKHELEKK
GHIFVSTTDSEVIAQLLVRELLKNDDIITAVTNVTQKLNGAYSLLIIYDDTLIAIRDPNG
FKPLCIGKDDGAYYFSSESCALDIVDVEFERDVAPGEMVVVDQNGLNTYKLPNAKEKASS
CMFEYVYFARPDSVIDGVSVYEVRRNIGKILARETPEEVDIVSPVPDSGIIFSQGYTEEA
EVPYYEALIKNRYIGRTFILPTQEERDLAVRLKLNPVKYLLKDKKVMLIDDSIVRGTTSG
KIMKMAKKAGAKEVHLRIGSPRIVSPCFYGIDMATTKELIANSKTDEEIAEMIGADSVAY
LSIEGLVEAIGRDDLCLACLNEEYPTDVSCKFECGNCKK