Protein Info for MMJJ_RS08430 in Methanococcus maripaludis JJ

Annotation: small nuclear ribonucleoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF01423: LSM" amino acids 11 to 71 (61 residues), 64.3 bits, see alignment E=3.3e-22

Best Hits

Swiss-Prot: 46% identical to RUXX_METAR: Putative snRNP Sm-like protein (UNCMA_29510) from Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)

KEGG orthology group: K04796, small nuclear ribonucleoprotein (inferred from 97% identity to mvn:Mevan_0470)

Predicted SEED Role

"Putative snRNP Sm-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>MMJJ_RS08430 small nuclear ribonucleoprotein (Methanococcus maripaludis JJ)
MMDTQRPLDALGKSINTNVTVYLKDGKVVKGRLKAYDLHMNVALENAKIENDEEKEFPML
VVRGDNVLYVSL