Protein Info for MMJJ_RS08405 in Methanococcus maripaludis JJ

Annotation: nickel-dependent hydrogenase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00374: NiFeSe_Hases" amino acids 42 to 113 (72 residues), 43.1 bits, see alignment E=3.1e-15 PF00346: Complex1_49kDa" amino acids 118 to 365 (248 residues), 150 bits, see alignment E=7.1e-48

Best Hits

Swiss-Prot: 73% identical to Y1027_METJA: Uncharacterized protein MJ1027 (MJ1027) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14123, energy-converting hydrogenase B subunit N (inferred from 98% identity to mmz:MmarC7_0401)

Predicted SEED Role

"Energy conserving hydrogenase Ehb large subunit (protein N)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>MMJJ_RS08405 nickel-dependent hydrogenase large subunit (Methanococcus maripaludis JJ)
MYEGEIAIGPVHSTMLEPHRLRLFIEDEIVKDAELTIGVNHRGVERLMEGLPVEKACILC
EKICGICSHIHLWSAARLVEIGCNIEIPERANHIRIIVEELERLHSHTLLFGHAFEILGH
ETMSMRCFMLREPIMQVFFEISGSRVHYSCPIIGGIRPRCNISDTQIPHILEKVSKYEEG
LNKFLERMLNDPMIISRVKDVGVMDRKTAAKFHAVGPTARGSNVKSDMRKWGWVPEYDPY
DFDEILFDSGDVFARLAVRFYECLESVKIIRQALDALKDTADKRIYNPNYELHEFKPINC
YTEAQRGEQYYSYGLDDEGLVRQAKIRTPTATNLGAMEDIVKGYHVSDAELIIASCDPCF
TCTDRLMVLKEPFKK