Protein Info for MMJJ_RS08365 in Methanococcus maripaludis JJ

Annotation: DsrE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02635: DsrE
  • amino acids 23 to 116 (94 residues), 33.2 bits, E=2.8e-12

Best Hits

Swiss-Prot: 62% identical to Y733_METJA: Uncharacterized protein MJ0733 (MJ0733) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP1161)

Predicted SEED Role

"Uncharacterized protein MJ0733"

Protein Sequence (116 amino acids)

>MMJJ_RS08365 DsrE family protein (Methanococcus maripaludis JJ)
MKTCFLIFTYDKGGKPYVPVIFHALLFAKEMKEKGDDVKIVFEGEAVKWFNELLKEDHPL
KSHVEALKDNFIACEACSNMFGVLDSIKGKIKIENDLHGHISLKKYLDSDYKVIEF