Protein Info for MMJJ_RS08360 in Methanococcus maripaludis JJ

Annotation: FprA family A-type flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00753: Lactamase_B" amino acids 32 to 196 (165 residues), 52.2 bits, see alignment E=1.6e-17 PF19583: ODP" amino acids 33 to 220 (188 residues), 101.3 bits, see alignment E=1.3e-32 PF12706: Lactamase_B_2" amino acids 44 to 145 (102 residues), 27.2 bits, see alignment E=5.6e-10 PF00258: Flavodoxin_1" amino acids 248 to 379 (132 residues), 56.1 bits, see alignment E=9.3e-19

Best Hits

Swiss-Prot: 64% identical to Y732_METJA: Uncharacterized protein MJ0732 (MJ0732) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1162)

Predicted SEED Role

"Flavoprotein MJ0732"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>MMJJ_RS08360 FprA family A-type flavoprotein (Methanococcus maripaludis JJ)
MAFTLKEGVYWVGAIDWNIREFHGYETKDGSSYNSYLIKDEKIVLIDTVKKYLFDEFYGR
IKKVVDPEKIDYIVVNHVEMDHSSSLEKIMEISKAKIITNQKAKEHLELHYNTKDWEYII
VDSGDSVNIGKRNLTFVKTPMLHWPDNMVTYCPEDKILFSNDAFGQHIASSERFDFEIDY
ALDSAKEYFANILLPYRTLIPNAVKTVDTLETDLICPSHGIIWKENISKIKEKYLEFASN
NVINKAVIVYDTMYSSTEKIGLAIAEGLIESGVEVKVFKISKTPVSKIIAEILDAKYVLV
GSPTLNINLYPEVARFLKYMEGLKPNKKIAAAFGSYGWAESATKHIKNTFDILSFDTVDD
ECLTCRFVPNEKHLKKCQEFGKKLAEM