Protein Info for MMJJ_RS08355 in Methanococcus maripaludis JJ
Annotation: divalent-cation tolerance protein CutA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to CUTA_PYRHO: Divalent-cation tolerance protein CutA (cutA) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 99% identity to mmp:MMP1163)Predicted SEED Role
"Periplasmic divalent cation tolerance protein CutA"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (104 amino acids)
>MMJJ_RS08355 divalent-cation tolerance protein CutA (Methanococcus maripaludis JJ) MEKPTLVYTTFPNFETAKSIVGYLLEKKMIACANLREHEAHYFNDGDVSINTEIGAFLKT TENRWISLKDMINEIHPLETPAILKINIDDSNDEFKNWILNIIK